PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family YABBY
Protein Properties Length: 106aa    MW: 12171.7 Da    PI: 9.3079
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006190genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY22.24e-07525323
        YABBY  3 vfssseqvCyvqCnfCntila 23
                 ++ sse+vCy++C+fCnt+la
  DCAR_006190  5 ITISSERVCYLHCTFCNTVLA 25
                 6779****************8 PP

2YABBY1005.2e-313478126170
        YABBY 126 PsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   saynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  DCAR_006190  34 LSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 78 
                  49*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.30.105.4E-53472IPR009071High mobility group box domain
SuperFamilySSF470951.4E-63471IPR009071High mobility group box domain
PfamPF046902.4E-293578IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MSTEITISSE RVCYLHCTFC NTVLAHQRRD NVFLSAYNRF IKEEIQRIKA SNPDISHREA  60
FSTAAKNWAH FPHIHFGLTR DSNKQAKLDH AMTSGEAQRS RPSFY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0533935e-39BT053393.1 Medicago truncatula clone MTYFP_FQ_FR_FS1G-O-9 unknown mRNA.
GenBankBT1360965e-39BT136096.1 Medicago truncatula clone JCVI-FLMt-10K9 unknown mRNA.
GenBankBT1438935e-39BT143893.1 Medicago truncatula clone JCVI-FLMt-10P10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008778121.14e-36PREDICTED: protein YABBY 2-like isoform X2
SwissprotQ8GW462e-30YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA9PGB21e-33A9PGB2_POPTR; Putative uncharacterized protein
STRINGPOPTR_0001s22180.17e-33(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-31YABBY family protein